Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis

J. Michael Conlon, Nadia Al-Ghaferi, Bency Abraham, Agnes Sonnevend, Laurent Coquet, Jérôme Leprince, Thierry Jouenne, Hubert Vaudry, Shawichi Iwamuro

Research output: Contribution to journalArticlepeer-review

33 Citations (Scopus)

Abstract

The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH2) lacks the cyclic heptapeptide domain Cys18-(Xaa)4-Lys-Cys24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant Staphylococcus aureus) (minimum inhibitory concentrations ≤ 25 μM) and relatively low hemolytic activity against human erythrocytes (LD50 = 100 μM). The peptide therefore represents a candidate for drug development.

Original languageEnglish
Pages (from-to)42-49
Number of pages8
JournalComparative Biochemistry and Physiology - C Toxicology and Pharmacology
Volume143
Issue number1
DOIs
Publication statusPublished - May 2006
Externally publishedYes

Keywords

  • Antimicrobial peptide
  • Brevinin-1
  • Brevinin-2
  • Frog skin
  • HPLC purification
  • Temporin

ASJC Scopus subject areas

  • Biochemistry
  • Physiology
  • Aquatic Science
  • Animal Science and Zoology
  • Toxicology
  • Cell Biology
  • Health, Toxicology and Mutagenesis

Fingerprint

Dive into the research topics of 'Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis'. Together they form a unique fingerprint.

Cite this